Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6B3 Rabbit Polyclonal Antibody (HRP)

OR6B3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR6B3P, OR6B3Q

UniProt

Q8NGW1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR6B3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RIPSATGCWRAFFTCASHLTVVTVFYTALLFMYVRPQAIDSRSSNKLISV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775486

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FPRL2 (Formyl Peptide Receptor-like 2, FMLP-related Receptor II, FMLP-R-II, N-formyl Peptide Receptor 3, FPR3, FPRH1) (MaxLight 750)
MBS6476773-01 0.1 mL

FPRL2 (Formyl Peptide Receptor-like 2, FMLP-related Receptor II, FMLP-R-II, N-formyl Peptide Receptor 3, FPR3, FPRH1) (MaxLight 750)

Sign In for Pricing
View Details
FPRL2 (Formyl Peptide Receptor-like 2, FMLP-related Receptor II, FMLP-R-II, N-formyl Peptide Receptor 3, FPR3, FPRH1) (MaxLight 750)
MBS6476773-02 5x 0.1 mL

FPRL2 (Formyl Peptide Receptor-like 2, FMLP-related Receptor II, FMLP-R-II, N-formyl Peptide Receptor 3, FPR3, FPRH1) (MaxLight 750)

Sign In for Pricing
View Details
DMRTA1, CT (DMRTA1, DMO, Doublesex- and mab-3-related transcription factor A1) (FITC) discontinued
034683-FITC 200 µL

DMRTA1, CT (DMRTA1, DMO, Doublesex- and mab-3-related transcription factor A1) (FITC) discontinued

Sign In for Pricing
View Details
rno-miR-873-5p Primers
MPR00846 150 µL / 10 µM

rno-miR-873-5p Primers

Sign In for Pricing
View Details
C-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (HRP) discontinued
C0026-11GX-HRP 100 µL

C-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (HRP) discontinued

Sign In for Pricing
View Details
hsa-miR-6732-3p miRNA Inhibitor
MIH03416 2x 5.0 nmol

hsa-miR-6732-3p miRNA Inhibitor

Sign In for Pricing
View Details