Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6B3 Rabbit Polyclonal Antibody (HRP)

OR6B3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR6B3P, OR6B3Q

UniProt

Q8NGW1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR6B3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RIPSATGCWRAFFTCASHLTVVTVFYTALLFMYVRPQAIDSRSSNKLISV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775486

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADARB1 Knockout HEK293T Polyclonal Cells
ARG25605 1 Million

ADARB1 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
FAM175A
CSB-CL747632HU2 10 μg Plasmid + 200 μL Glycerol

FAM175A

Sign In for Pricing
View Details
XPA, CT (Xeroderma Pigmentosum Complementation Group A, Xeroderma Pigmentosum Group A Complementing Protein, Xpac, DNA Repair Protein Complementing XP A Cells, DNA Repair Protein Complementing XPA Cells, DNA Repair Protein Complementing XP-A Cells, Excision Repair Controlling, Xeroderma Pigmentosum 1, XP1) (Biotin) discontinued
X1045-02D-Biotin 200 µL

XPA, CT (Xeroderma Pigmentosum Complementation Group A, Xeroderma Pigmentosum Group A Complementing Protein, Xpac, DNA Repair Protein Complementing XP A Cells, DNA Repair Protein Complementing XPA Cells, DNA Repair Protein Complementing XP-A Cells, Excision Repair Controlling, Xeroderma Pigmentosum 1, XP1) (Biotin) discontinued

Sign In for Pricing
View Details
ZNF41 (Zinc Finger Protein 41, MGC8941, MRX89) (FITC)
MBS6175019-01 0.1 mL

ZNF41 (Zinc Finger Protein 41, MGC8941, MRX89) (FITC)

Sign In for Pricing
View Details
ZNF41 (Zinc Finger Protein 41, MGC8941, MRX89) (FITC)
MBS6175019-02 5x 0.1 mL

ZNF41 (Zinc Finger Protein 41, MGC8941, MRX89) (FITC)

Sign In for Pricing
View Details
Rat Growth-Associated Protein 43 (GAP-43) ELISA Kit
MBS3808287-01 48 Well

Rat Growth-Associated Protein 43 (GAP-43) ELISA Kit

Sign In for Pricing
View Details