Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8G1 Rabbit Polyclonal Antibody (FITC)

OR8G1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OR8G1P, TPCR25, HSTPCR25

UniProt

Q15617

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR8G1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EGRSKAFSTCSSHMLAVVIFFGSAAFMYLQPSSISSMDQGKVSSVFYTII

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001002905

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4933407P14Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)
10746094 4x 500 ng

4933407P14Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
HORMAD2-set siRNA/shRNA/RNAi Lentivector (Human)
23792091 4x 500 ng

HORMAD2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
AP1S1 (AP-1 Complex Subunit sigma-1A, Adapter-related Protein Complex 1 sigma-1A Subunit, Adaptor Protein Complex AP-1 sigma-1A Subunit, Clathrin Assembly Protein Complex 1 sigma-1A Small Chain, Clathrin Coat Assembly Protein AP19, Golgi Adaptor HA1/AP1 Adaptin sigma-1A Subunit, HA1 19kD Subunit, Sigma 1a Subunit of AP-1 Clathrin, Sigma-adaptin 1A, Sigma1A-adaptin, AP19, CLAPS1)
123377 50 µg

AP1S1 (AP-1 Complex Subunit sigma-1A, Adapter-related Protein Complex 1 sigma-1A Subunit, Adaptor Protein Complex AP-1 sigma-1A Subunit, Clathrin Assembly Protein Complex 1 sigma-1A Small Chain, Clathrin Coat Assembly Protein AP19, Golgi Adaptor HA1/AP1 Adaptin sigma-1A Subunit, HA1 19kD Subunit, Sigma 1a Subunit of AP-1 Clathrin, Sigma-adaptin 1A, Sigma1A-adaptin, AP19, CLAPS1)

Sign In for Pricing
View Details
LRIG1 Rabbit Polyclonal Antibody
E53P07976 100 µL

LRIG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PNP Mouse Monoclonal Antibody (Fluoro550)
orb3085508 100 µg

PNP Mouse Monoclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
ELF2 Rabbit Polyclonal Antibody (Biotin)
orb2142765 100 µL

ELF2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details