Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR9G9 Rabbit Polyclonal Antibody (Biotin)

OR9G9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OR9G1

UniProt

P0C7N8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR9G9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YIYALPRSSYSFDMDKIVSTFYTEVLPMLNPMIYSLRNKDVKEALKKLLP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001013376

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOSPD3 (Motile Sperm Domain Containing 3, CDS3)
588563 50 µg

MOSPD3 (Motile Sperm Domain Containing 3, CDS3)

Sign In for Pricing
View Details
Recombinant Human Regulation of nuclear pre-mRNA domain-containing protein 1A (RPRD1A)
MBS1300341-01 0.02 mg (E-Coli)

Recombinant Human Regulation of nuclear pre-mRNA domain-containing protein 1A (RPRD1A)

Sign In for Pricing
View Details
Recombinant Human Regulation of nuclear pre-mRNA domain-containing protein 1A (RPRD1A)
MBS1300341-02 0.02 mg (Yeast)

Recombinant Human Regulation of nuclear pre-mRNA domain-containing protein 1A (RPRD1A)

Sign In for Pricing
View Details
Recombinant Human Regulation of nuclear pre-mRNA domain-containing protein 1A (RPRD1A)
MBS1300341-03 0.1 mg (E-Coli)

Recombinant Human Regulation of nuclear pre-mRNA domain-containing protein 1A (RPRD1A)

Sign In for Pricing
View Details
Recombinant Human Regulation of nuclear pre-mRNA domain-containing protein 1A (RPRD1A)
MBS1300341-04 0.1 mg (Yeast)

Recombinant Human Regulation of nuclear pre-mRNA domain-containing protein 1A (RPRD1A)

Sign In for Pricing
View Details
Recombinant Human Regulation of nuclear pre-mRNA domain-containing protein 1A (RPRD1A)
MBS1300341-05 0.02 mg (Baculovirus)

Recombinant Human Regulation of nuclear pre-mRNA domain-containing protein 1A (RPRD1A)

Sign In for Pricing
View Details