Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10A2 Rabbit Polyclonal Antibody (HRP)

OR10A2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OST363, OR10A2P, OR11-82, OR11-86

UniProt

Q9H208

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10A2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SHLLVVSLFYISLSLTYFRPKSNNSPEGKKLLSLSYTVMTPMLNPIIYSL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Metallothionein-1X, MT1X ELISA KIT
ELI-19359h 96 Tests

Human Metallothionein-1X, MT1X ELISA KIT

Sign In for Pricing
View Details
Prl8a4 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
37702156 3x 1.0 µg DNA

Prl8a4 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Neurogenin3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-0922R-BF488-01 20 µL

Neurogenin3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Neurogenin3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-0922R-BF488-02 100 µL

Neurogenin3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Slco2b1 ORF Vector (Mouse) (pORF)
ORF057877 1.0 µg DNA

Slco2b1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Monoclonal Antibody to Endonuclease G, Mitochondrial (ENDOG)
TRV-0060920-01 20 µL

Monoclonal Antibody to Endonuclease G, Mitochondrial (ENDOG)

Sign In for Pricing
View Details