Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIAL4C Rabbit Polyclonal Antibody (Biotin)

PPIAL4C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

COAS-2

UniProt

Q9Y536

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PPIAL4C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NGSQFFICAAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKIT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

XP_003846538

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC10A1, CT (SLC10A1, NTCP, Sodium/bile acid cotransporter, Cell growth-inhibiting gene 29 protein, Na (+) /bile acid cotransporter, Na (+) /taurocholate transport protein, Sodium/taurocholate cotransporting polypeptide, Solute carrier family 10 member 1) (MaxLight 490) discontinued
041782-ML490 100 µL

SLC10A1, CT (SLC10A1, NTCP, Sodium/bile acid cotransporter, Cell growth-inhibiting gene 29 protein, Na (+) /bile acid cotransporter, Na (+) /taurocholate transport protein, Sodium/taurocholate cotransporting polypeptide, Solute carrier family 10 member 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
AdmiRa-hsa-miR-149-5p-Off Virus
mh5210 1.0 mL

AdmiRa-hsa-miR-149-5p-Off Virus

Sign In for Pricing
View Details
LDHAL6A Rabbit Polyclonal Antibody (AP)
orb953365 100 µL

LDHAL6A Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Lentiviral human RAB29 shRNA (UAS) - Lentiviral human RAB29 shRNA (UAS, GFP) (25)
GTR15322739 1 Vial

Lentiviral human RAB29 shRNA (UAS) - Lentiviral human RAB29 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Anti-SNPH Antibody Picoband® (Biotine Conjugate)
A08882-1-Biotin 100 µg/Vial

Anti-SNPH Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
CD117 Mouse Gene Knockout Kit (CRISPR)
KN508813 1 Kit

CD117 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details