Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPN20 Rabbit Polyclonal Antibody (Biotin)

PTPN20 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CT126, PTPN20A, PTPN20B, bA42B19.1, bA142I17.1

UniProt

Q4JDL3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PTPN20B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ETLPSSSQENTPRSKVFENKVNSEKVKLSLRNFPHNDYEDVFEEPSESGS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-EGFR (Tyr845) Rabbit Polyclonal Antibody
orb6012-01 50 μL

Phospho-EGFR (Tyr845) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-EGFR (Tyr845) Rabbit Polyclonal Antibody
orb6012-02 100 µL

Phospho-EGFR (Tyr845) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-EGFR (Tyr845) Rabbit Polyclonal Antibody
orb6012-03 200 µL

Phospho-EGFR (Tyr845) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Chemotaxis protein CheY homolog (cheY)
MBS1010948-01 0.02 mg (E-Coli)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Chemotaxis protein CheY homolog (cheY)

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Chemotaxis protein CheY homolog (cheY)
MBS1010948-02 0.1 mg (E-Coli)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Chemotaxis protein CheY homolog (cheY)

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Chemotaxis protein CheY homolog (cheY)
MBS1010948-03 0.02 mg (Yeast)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Chemotaxis protein CheY homolog (cheY)

Sign In for Pricing
View Details