Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAPGEFL1 Rabbit Polyclonal Antibody (FITC)

RAPGEFL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Link-GEFII

UniProt

Q9UHV5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAPGEFL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KFKNLFRKFENLTDPCRNHKSYREVISKMKPPVIPFVPLILKDLTFLHEG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CHD8 Antibody [Alexa Fluor 750]
NB100-60417AF750 100 µL

Rabbit Polyclonal CHD8 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Cyclin D1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-52046R-BF405-TR 20 µL

Cyclin D1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
KLHL7 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-5935R-BF555 100 µL

KLHL7 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
MAdCAM-1 Polyclonal Antibody, Cy5 Conjugated
bs-0642R-Cy5 100 µL

MAdCAM-1 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
TSPY2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2543506 1.0 µg DNA

TSPY2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3)
CSB-BP883621HU-01 10 µg

Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3)

Sign In for Pricing
View Details