Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERINC4 Rabbit Polyclonal Antibody (HRP)

SERINC4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A6NH21

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SERINC4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IVKVYSYEFQKPSLCFCCPETVEADKGQRGGAARPADQETPPAPPVQVQH

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001244961

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP Kinase p44/42 (MAPK3/MAPK1, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, Mapk, ERT1, Extracellular Signal-regulated Kinase 2, ERK-2, MAP Kinase Isoform p42, p42-MAPK, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, ERK2, PRKM1 / Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, ERT2, Extracellular Signal-regulated Kinase 1, ERK-1, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, p44-MAPK, Microtubule-associated Protein 2 Kinase, MNK1, p44-ERK1, ERK1, PRKM3) (PE)
M2360-02K-PE 100 µL

MAP Kinase p44/42 (MAPK3/MAPK1, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, Mapk, ERT1, Extracellular Signal-regulated Kinase 2, ERK-2, MAP Kinase Isoform p42, p42-MAPK, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, ERK2, PRKM1 / Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, ERT2, Extracellular Signal-regulated Kinase 1, ERK-1, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, p44-MAPK, Microtubule-associated Protein 2 Kinase, MNK1, p44-ERK1, ERK1, PRKM3) (PE)

Sign In for Pricing
View Details
PGM2 Human Over-expression Lysate
orb1369855 20 µg

PGM2 Human Over-expression Lysate

Sign In for Pricing
View Details
CLEC2D Recombinant Protein (Rat)
RP195293 100 µg

CLEC2D Recombinant Protein (Rat)

Sign In for Pricing
View Details
EF-hand domain-containing protein D2 (EFHD2) Bovine ELISA Kit
D1125 96 Tests

EF-hand domain-containing protein D2 (EFHD2) Bovine ELISA Kit

Sign In for Pricing
View Details
TUSC3 Protein Vector (Rat) (pPM-C-HA)
PV313788 500 ng

TUSC3 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
ZNF285 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV805369 1.0 µg DNA

ZNF285 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details