Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED6 Rabbit Polyclonal Antibody (FITC)

TMED6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P24g5, PRO34237, SPLL9146

UniProt

Q8WW62

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMED6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARM

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_653277

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HECTD1 Polyclonal Antibody, Cy3 Conjugated
bs-15446R-Cy3 100 µL

HECTD1 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
MAGEB2, NT (Melanoma-associated Antigen B2, MAGE-B2 Antigen, DSS-AHC Critical Interval MAGE Superfamily 6, DAM6, MAGE XP-2 Antigen, Cancer/Testis Antigen 3.2, CT3.2) (MaxLight 550) discontinued
M1750-23-ML550 100 µL

MAGEB2, NT (Melanoma-associated Antigen B2, MAGE-B2 Antigen, DSS-AHC Critical Interval MAGE Superfamily 6, DAM6, MAGE XP-2 Antigen, Cancer/Testis Antigen 3.2, CT3.2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal GALK1 Antibody [Alexa Fluor 488]
NBP2-99783AF488 0.1 mL

Rabbit Polyclonal GALK1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
ANXA8 Protein Vector (Human) (pPM-C-His)
PV001852 500 ng

ANXA8 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Psen1 ELISA Kit (Mouse)
OKCD01650-96W 96 Well

Psen1 ELISA Kit (Mouse)

Sign In for Pricing
View Details
Tmc6 (NM_181321) Mouse Tagged ORF Clone Lentiviral Particle
MR220428L3V 200 µL

Tmc6 (NM_181321) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details