Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF772 Rabbit Polyclonal Antibody (HRP)

ZNF772 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q68DY9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF772

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAEHQETHPGQKPYMCVLCGKQFCFSANLHQHQKQHSGEKPFRSDKSRPF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001137540

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IgL Antibody (LLC/1738) [DyLight 680]
NBP2-54420FR 100 µL

Mouse Monoclonal IgL Antibody (LLC/1738) [DyLight 680]

Sign In for Pricing
View Details
Anti-MKP-1/DUSP1 Antibody Picoband®, Cy3 Conjugate
A02276-1-Cy3 100 µg/Vial

Anti-MKP-1/DUSP1 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Silicone Rubber Tubing  O.D. : 7.5 ±
PW300-5MT 1 unit

Silicone Rubber Tubing O.D. : 7.5 ±

Sign In for Pricing
View Details
Lamin B1 Rabbit Monoclonal Antibody, 1 pack = 100 µLx10
BAL1439 1 Each

Lamin B1 Rabbit Monoclonal Antibody, 1 pack = 100 µLx10

Sign In for Pricing
View Details
Bovine Nerve growth factor,NGF ELISA KIT
JOT-EK0405Bo-01 96 Well

Bovine Nerve growth factor,NGF ELISA KIT

Sign In for Pricing
View Details
Bovine Nerve growth factor,NGF ELISA KIT
JOT-EK0405Bo-02 48 Well

Bovine Nerve growth factor,NGF ELISA KIT

Sign In for Pricing
View Details