Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNK Rabbit Polyclonal Antibody (FITC)

UNK Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Unkh, Zc3h5, Zc3hdc5, mKIAA1753, B230379M23Rik

UniProt

Q8BL48

Immunogen

The immunogen is a synthetic peptide directed towards the Middle region of Mouse UNK

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YVLGNYKTEPCKKPPRLCRQGYACPYYHNSKDRRRSPRKHKYRSSPCPNV

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

87 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCC12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0020208 1.0 µg DNA

ABCC12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
WNT7B Rabbit Polyclonal Antibody (BF405)
orb2402166 100 µL

WNT7B Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Cdc25A Rabbit Polyclonal Antibody (PE)
orb485135 100 µL

Cdc25A Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A UPF0235 protein yggU (yggU)
MBS1242905-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi A UPF0235 protein yggU (yggU)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A UPF0235 protein yggU (yggU)
MBS1242905-02 0.1 mg (E-Coli)

Recombinant Salmonella paratyphi A UPF0235 protein yggU (yggU)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A UPF0235 protein yggU (yggU)
MBS1242905-03 0.02 mg (Yeast)

Recombinant Salmonella paratyphi A UPF0235 protein yggU (yggU)

Sign In for Pricing
View Details