Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFAIP2 Rabbit Polyclonal Antibody (Biotin)

TNFAIP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

B94, EXOC3L3

UniProt

Q03169

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TNFAIP2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EAAKKKKEKKKKSKGLANVFCVFTKGKKKKGQPSSAEPEDAAGSRQGLDG

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_006282

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Med13l 3'UTR Luciferase Stable Cell Line
TU113047 1.0 mL

Med13l 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Y14 (RBM8A) (NM_005105) Human Recombinant Protein
TP309770 20 µg

Y14 (RBM8A) (NM_005105) Human Recombinant Protein

Sign In for Pricing
View Details
RECK (Reversion-inducing Cysteine-rich Protein with Kazal Motifs, hRECK, Suppressor of Tumorigenicity 15 Protein, ST15) (Biotin)
MBS6392278-01 0.1 mL

RECK (Reversion-inducing Cysteine-rich Protein with Kazal Motifs, hRECK, Suppressor of Tumorigenicity 15 Protein, ST15) (Biotin)

Sign In for Pricing
View Details
RECK (Reversion-inducing Cysteine-rich Protein with Kazal Motifs, hRECK, Suppressor of Tumorigenicity 15 Protein, ST15) (Biotin)
MBS6392278-02 5x 0.1 mL

RECK (Reversion-inducing Cysteine-rich Protein with Kazal Motifs, hRECK, Suppressor of Tumorigenicity 15 Protein, ST15) (Biotin)

Sign In for Pricing
View Details
Ne-Z-L-lysine methyl ester hydrochloride 98+% (HPLC)
240905-01 5 g

Ne-Z-L-lysine methyl ester hydrochloride 98+% (HPLC)

Sign In for Pricing
View Details
Ne-Z-L-lysine methyl ester hydrochloride 98+% (HPLC)
240905-02 25 g

Ne-Z-L-lysine methyl ester hydrochloride 98+% (HPLC)

Sign In for Pricing
View Details