Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SENP7 Rabbit Polyclonal Antibody (HRP)

SENP7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9BQF6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SENP7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLESYQNLNPHKSCYLSERGSQRSKTVDDNSAKQTAHNKEKRRKDDGISL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Clathrin Heavy Chain 1/CHC17 Antibody (X22) [Alexa Fluor 350]
NB300-613AF350 0.1 mL

Mouse Monoclonal Clathrin Heavy Chain 1/CHC17 Antibody (X22) [Alexa Fluor 350]

Sign In for Pricing
View Details
Estrogen Related Receptor alpha (ESRRA) Mouse Monoclonal Antibody [Clone ID: LBI2H9]
AMM18801VCF 100 µg

Estrogen Related Receptor alpha (ESRRA) Mouse Monoclonal Antibody [Clone ID: LBI2H9]

Sign In for Pricing
View Details
Mouse Monoclonal CAPZA1 Antibody (OTI2G4) [Alexa Fluor 750]
NBP2-70336AF750 0.1 mL

Mouse Monoclonal CAPZA1 Antibody (OTI2G4) [Alexa Fluor 750]

Sign In for Pricing
View Details
Synapsin1 Antibody (Phospho-Ser605) : HRP (OAAF07598-HRP)
OAAF07598-100UG-HRP 100 µg

Synapsin1 Antibody (Phospho-Ser605) : HRP (OAAF07598-HRP)

Sign In for Pricing
View Details
SCO1 Antibody
orb1239014-01 0.02 mg

SCO1 Antibody

Sign In for Pricing
View Details
SCO1 Antibody
orb1239014-02 0.1 mg

SCO1 Antibody

Sign In for Pricing
View Details