Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SENP7 Rabbit Polyclonal Antibody (HRP)

SENP7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9BQF6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SENP7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLESYQNLNPHKSCYLSERGSQRSKTVDDNSAKQTAHNKEKRRKDDGISL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MLLT3 qPCR Primer Pair
QH18201S 200 Tests

Human MLLT3 qPCR Primer Pair

Sign In for Pricing
View Details
TOMM34 3'UTR GFP Stable Cell Line
TU076103 1.0 mL

TOMM34 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human Histone deacetylase 11 (HDAC11)
orb1647615-01 20 µg

Recombinant Human Histone deacetylase 11 (HDAC11)

Sign In for Pricing
View Details
Recombinant Human Histone deacetylase 11 (HDAC11)
orb1647615-02 100 µg

Recombinant Human Histone deacetylase 11 (HDAC11)

Sign In for Pricing
View Details
Recombinant Human Histone deacetylase 11 (HDAC11)
orb1647615-03 1 mg

Recombinant Human Histone deacetylase 11 (HDAC11)

Sign In for Pricing
View Details
Angptl4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7533607 1.0 µg DNA

Angptl4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details