Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STRN3 Rabbit Polyclonal Antibody (HRP)

STRN3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SG2NA, S/G2NA, PPP2R6B

UniProt

Q13033

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human STRN3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HKIGNEGLAADLTDDPDTEEALKEFDFLVTAEDGEGAGEARSSGDGTEWV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001077362.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCL6 (C-X-C Motif Chemokine 6, Chemokine alpha 3, CKA-3, Granulocyte Chemotactic Protein 2, GCP-2, Small-inducible Cytokine B6, GCP2, SCYB6) (MaxLight 490)
125508-ML490 100 µL

CXCL6 (C-X-C Motif Chemokine 6, Chemokine alpha 3, CKA-3, Granulocyte Chemotactic Protein 2, GCP-2, Small-inducible Cytokine B6, GCP2, SCYB6) (MaxLight 490)

Sign In for Pricing
View Details
Hepatitis C Virus (HCV) Core Antigen (FITC)
MBS6125379-01 0.1 mL

Hepatitis C Virus (HCV) Core Antigen (FITC)

Sign In for Pricing
View Details
Hepatitis C Virus (HCV) Core Antigen (FITC)
MBS6125379-02 5x 0.1 mL

Hepatitis C Virus (HCV) Core Antigen (FITC)

Sign In for Pricing
View Details
Alox15 Rat siRNA Oligo Duplex (Locus ID 81639)
SR503719 1 Kit

Alox15 Rat siRNA Oligo Duplex (Locus ID 81639)

Sign In for Pricing
View Details
Lentiviral human FAM50B sgRNA gene knockout kit - Lentiviral human FAM50B sgRNA gene knockout kit (25)
GTR15371070 1 Vial

Lentiviral human FAM50B sgRNA gene knockout kit - Lentiviral human FAM50B sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Scnn1a-set siRNA/shRNA/RNAi Lentivector (Mouse)
43190094 4x 500 ng

Scnn1a-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details