Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPB41L3 Rabbit Polyclonal Antibody (HRP)

EPB41L3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

4.1B, DAL1, DAL-1

UniProt

Q9Y2J2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human E41L3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CETP (Cholesteryl Ester Transfer Protein, BPIFF, HDLCQ10, CETP) (AP)
MBS6411294-01 0.1 mL

CETP (Cholesteryl Ester Transfer Protein, BPIFF, HDLCQ10, CETP) (AP)

Sign In for Pricing
View Details
CETP (Cholesteryl Ester Transfer Protein, BPIFF, HDLCQ10, CETP) (AP)
MBS6411294-02 5x 0.1 mL

CETP (Cholesteryl Ester Transfer Protein, BPIFF, HDLCQ10, CETP) (AP)

Sign In for Pricing
View Details
RNF19A CRISPRa sgRNA lentivector (set of three targets)(Rat)
40281126 3x 1.0µg DNA

RNF19A CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Ribociclib Nitroso Impurity 19
RM-R090219-01 10 mg

Ribociclib Nitroso Impurity 19

Sign In for Pricing
View Details
Ribociclib Nitroso Impurity 19
RM-R090219-02 100 mg

Ribociclib Nitroso Impurity 19

Sign In for Pricing
View Details
Ribociclib Nitroso Impurity 19
RM-R090219-03 25 mg

Ribociclib Nitroso Impurity 19

Sign In for Pricing
View Details