Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYS1 Rabbit Polyclonal Antibody (Biotin)

SYS1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C20orf169, dJ453C12.4, dJ453C12.4.1

UniProt

Q8N2H4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SYS1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CWFYSSRFPSALTWWLVQAVCIALMAVIGEYLCMRTELKEIPLNSAPKSN

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_291020.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF35, ID (ARHGEF35, ARHGEF5L, Rho guanine nucleotide exchange factor 35, Rho guanine nucleotide exchange factor 5-like protein)
MBS649084-01 0.2 mL

ARHGEF35, ID (ARHGEF35, ARHGEF5L, Rho guanine nucleotide exchange factor 35, Rho guanine nucleotide exchange factor 5-like protein)

Sign In for Pricing
View Details
ARHGEF35, ID (ARHGEF35, ARHGEF5L, Rho guanine nucleotide exchange factor 35, Rho guanine nucleotide exchange factor 5-like protein)
MBS649084-02 5x 0.2 mL

ARHGEF35, ID (ARHGEF35, ARHGEF5L, Rho guanine nucleotide exchange factor 35, Rho guanine nucleotide exchange factor 5-like protein)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae A-agglutinin-binding subunit
MBS1074393-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae A-agglutinin-binding subunit

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae A-agglutinin-binding subunit
MBS1074393-02 0.1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae A-agglutinin-binding subunit

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae A-agglutinin-binding subunit
MBS1074393-03 1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae A-agglutinin-binding subunit

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae A-agglutinin-binding subunit
MBS1074393-04 5x 1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae A-agglutinin-binding subunit

Sign In for Pricing
View Details