Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BLZF1 Rabbit Polyclonal Antibody (HRP)

BLZF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

JEM1, JEM-1, JEM-1s, GOLGIN-45

UniProt

Q9H2G9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human BLZF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AETVLRILDPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENIT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_003657

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Matrix Metalloproteinase 5 MMP5 ELISA Kit
BG-BVN11607 1 Each

Bovine Matrix Metalloproteinase 5 MMP5 ELISA Kit

Sign In for Pricing
View Details
ATP6V1A (V-type Proton ATPase Catalytic Subunit A, V-ATPase Subunit A, V-ATPase 69kD Subunit, Vacuolar ATPase Isoform VA68, Vacuolar Proton Pump Subunit alpha, ATP6A1, ATP6V1A1, VPP2) (Biotin)
123721-Biotin 100 µL

ATP6V1A (V-type Proton ATPase Catalytic Subunit A, V-ATPase Subunit A, V-ATPase 69kD Subunit, Vacuolar ATPase Isoform VA68, Vacuolar Proton Pump Subunit alpha, ATP6A1, ATP6V1A1, VPP2) (Biotin)

Sign In for Pricing
View Details
Goat Anti-Mouse IgG (H&L) Biotin
6918-100 100 µL

Goat Anti-Mouse IgG (H&L) Biotin

Sign In for Pricing
View Details
PTP alpha Antibody
MBS9611038-01 0.05 mL

PTP alpha Antibody

Sign In for Pricing
View Details
PTP alpha Antibody
MBS9611038-02 0.1 mL

PTP alpha Antibody

Sign In for Pricing
View Details
PTP alpha Antibody
MBS9611038-03 0.2 mL

PTP alpha Antibody

Sign In for Pricing
View Details