Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Synaptotagmin Protein, Human (N-His)

The Ptk7 protein is a receptor involved in multiple cellular processes, including cell proliferation and migration. It plays a crucial role in regulating embryonic development and tissue homeostasis. Synaptotagmin VI Protein, Human (N-His) is the recombinant human-derived Synaptotagmin VI protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Synaptotagmin VI Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/synaptotagmin-vi-protein-human-n-his.html

Purity

98.0

Smiles

VDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGITAEGLGRDHWNEMLAYPRKPIAHWHSLVEVKKSFKEGNPRL

Molecular Formula

148281 (Gene_ID) NP_995320 (V275-L425) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse ATPase, Na+/K+ Transporting Alpha 2 Polypeptide (ATP1a2) ELISA Kit
orb1667737-01 48 Tests

Mouse ATPase, Na+/K+ Transporting Alpha 2 Polypeptide (ATP1a2) ELISA Kit

Sign In for Pricing
View Details
Mouse ATPase, Na+/K+ Transporting Alpha 2 Polypeptide (ATP1a2) ELISA Kit
orb1667737-02 96 Tests

Mouse ATPase, Na+/K+ Transporting Alpha 2 Polypeptide (ATP1a2) ELISA Kit

Sign In for Pricing
View Details
ELISA Kit for Rho Related BTB Domain Containing Protein 3 (RHOBTB3)
TRV-0006002 96 Well Plate

ELISA Kit for Rho Related BTB Domain Containing Protein 3 (RHOBTB3)

Sign In for Pricing
View Details
SMAD2 (NM_005901) Human Mass Spec Standard
PH304604 10 µg

SMAD2 (NM_005901) Human Mass Spec Standard

Sign In for Pricing
View Details
Liensinine Perchlorate 5mg
A14742-5 5 mg

Liensinine Perchlorate 5mg

Sign In for Pricing
View Details
Mouse Monoclonal ACOT8 Antibody (4D10) [DyLight 405]
NBP2-59419V 0.1 mL

Mouse Monoclonal ACOT8 Antibody (4D10) [DyLight 405]

Sign In for Pricing
View Details