Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGBP1 Rabbit Polyclonal Antibody (HRP)

IGBP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IBP1, alpha4, ALPHA-4

UniProt

P78318

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IGBP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APEEFRKAAQQQEEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGNRQNM

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001542.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRS2 (A-5) : m-IgG2b BP-HRP Bundle
sc-550030 1 Kit

FRS2 (A-5) : m-IgG2b BP-HRP Bundle

Sign In for Pricing
View Details
Anti-TICN1 SPOCK1 Antibody
A06588 100 µL

Anti-TICN1 SPOCK1 Antibody

Sign In for Pricing
View Details
GABPA (GA Binding Protein Transcription Factor, alpha Subunit 60kD, E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A) (APC)
MBS6166786-01 0.1 mL

GABPA (GA Binding Protein Transcription Factor, alpha Subunit 60kD, E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A) (APC)

Sign In for Pricing
View Details
GABPA (GA Binding Protein Transcription Factor, alpha Subunit 60kD, E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A) (APC)
MBS6166786-02 5x 0.1 mL

GABPA (GA Binding Protein Transcription Factor, alpha Subunit 60kD, E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A) (APC)

Sign In for Pricing
View Details
Donkey UPF0467 Protein C5orf32 (C5ORF32) ELISA Kit
MBS9933528 Inquire

Donkey UPF0467 Protein C5orf32 (C5ORF32) ELISA Kit

Sign In for Pricing
View Details
SSX3 Human Over-expression Lysate
orb1354203 100 µg

SSX3 Human Over-expression Lysate

Sign In for Pricing
View Details