Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF32 Rabbit Polyclonal Antibody (FITC)

ZNF32 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KOX30, ZNF637, Zfp637

UniProt

P17041

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF32

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HSEATGSSSWDIQNSFRREKLEQKSPDSKTLQEDSPGVRQRVYECQECGK

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_008904.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGB2 Antibody
orb1730331 100 µL

HMGB2 Antibody

Sign In for Pricing
View Details
Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) Magnetic Fluorescence Assay Kit
MBS2161564-01 96 Tests

Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) Magnetic Fluorescence Assay Kit
MBS2161564-02 5x 96 Tests

Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) Magnetic Fluorescence Assay Kit
MBS2161564-03 10x 96 Tests

Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans sams-5 Polyclonal Antibody
MBS7192113 Inquire

Rabbit anti-Caenorhabditis elegans sams-5 Polyclonal Antibody

Sign In for Pricing
View Details
HIST1H2BK CRISPRa sgRNA lentivector (set of three targets)(Human)
23345121 3x 1.0µg DNA

HIST1H2BK CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details