Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX12 Rabbit Polyclonal Antibody (Biotin)

STX12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

STX13, STX14

UniProt

Q86Y82

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human STX12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PLDMYRNPGPSGPQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQ

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_803173.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAP1L1, CT (NAP1L1, NRP, Nucleosome assembly protein 1-like 1, NAP-1-related protein) (MaxLight 650) discontinued
038789-ML650 100 µL

NAP1L1, CT (NAP1L1, NRP, Nucleosome assembly protein 1-like 1, NAP-1-related protein) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Transforming Growth Factor beta 1 (TGFb1, TGF-beta-1, TGFB1, TGFB) (MaxLight 550)
MBS6255359-01 0.1 mL

Transforming Growth Factor beta 1 (TGFb1, TGF-beta-1, TGFB1, TGFB) (MaxLight 550)

Sign In for Pricing
View Details
Transforming Growth Factor beta 1 (TGFb1, TGF-beta-1, TGFB1, TGFB) (MaxLight 550)
MBS6255359-02 5x 0.1 mL

Transforming Growth Factor beta 1 (TGFb1, TGF-beta-1, TGFB1, TGFB) (MaxLight 550)

Sign In for Pricing
View Details
Anti-SIGLEC9 Antibody
A06748 100 µL

Anti-SIGLEC9 Antibody

Sign In for Pricing
View Details
Human Retinoic acid receptor beta ELISA Kit
MBS9426513-01 96 Tests

Human Retinoic acid receptor beta ELISA Kit

Sign In for Pricing
View Details
Human Retinoic acid receptor beta ELISA Kit
MBS9426513-02 5x 96 Tests

Human Retinoic acid receptor beta ELISA Kit

Sign In for Pricing
View Details