Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBXN1 Rabbit Polyclonal Antibody (HRP)

UBXN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

2B28, SAKS1, UBXD10

UniProt

Q04323

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human UBXN1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPTSS

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF405S conjugate, 0.1mg/mL
BNC042843-100 1x 100 µL

SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human AK6 activation kit by CRISPRa
GA119527 1 Kit

Human AK6 activation kit by CRISPRa

Sign In for Pricing
View Details
PEX11A (NM_003847) Human Over-expression Lysate
LY401264 100 µg

PEX11A (NM_003847) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human OXA Protein (Sumo Tag)
PDEH100576-01 20 µg

Recombinant Human OXA Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human OXA Protein (Sumo Tag)
PDEH100576-02 100 µg

Recombinant Human OXA Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human OXA Protein (Sumo Tag)
PDEH100576-03 500 µg

Recombinant Human OXA Protein (Sumo Tag)

Sign In for Pricing
View Details