Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UIMC1 Rabbit Polyclonal Antibody (HRP)

UIMC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RAP80, X2HRIP110

UniProt

Q96RL1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human UIMC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GIPFCPDGVDPNQYTKVILCQLEVYQKSLKMAQRQLLNKKGFGEPVLPRP

Field of Research

Epigenetics & Chromatin

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Streptococcus pneumoniae Monoclonal Antibody
VAnt-Wyb534 Each

Streptococcus pneumoniae Monoclonal Antibody

Sign In for Pricing
View Details
Hmgn2 3'UTR Luciferase Stable Cell Line
TU205847 1.0 mL

Hmgn2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Bag5 (NM_001008526) Rat Tagged ORF Clone Lentiviral Particle
RR201099L4V 200 µL

Bag5 (NM_001008526) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Tripartite Motif-Containing 24 (TRIM24) ELISA Kit
abx383925 96 Tests

Human Tripartite Motif-Containing 24 (TRIM24) ELISA Kit

Sign In for Pricing
View Details
GTPBP4 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
22821124 3x 1.0µg DNA

GTPBP4 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
OR2AG1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1491507 1.0 µg DNA

OR2AG1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details