Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UIMC1 Rabbit Polyclonal Antibody (HRP)

UIMC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RAP80, X2HRIP110

UniProt

Q96RL1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human UIMC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GIPFCPDGVDPNQYTKVILCQLEVYQKSLKMAQRQLLNKKGFGEPVLPRP

Field of Research

Epigenetics & Chromatin

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JTT 551
T11730-01 25 mg

JTT 551

Sign In for Pricing
View Details
JTT 551
T11730-02 50 mg

JTT 551

Sign In for Pricing
View Details
JTT 551
T11730-03 100 mg

JTT 551

Sign In for Pricing
View Details
NPFFR2, NT (NPFFR2, GPR74, NPFF2, NPGPR, Neuropeptide FF receptor 2, G-protein coupled receptor 74, G-protein coupled receptor HLWAR77, Neuropeptide G-protein coupled receptor) (AP) discontinued
039087-AP 200 µL

NPFFR2, NT (NPFFR2, GPR74, NPFF2, NPGPR, Neuropeptide FF receptor 2, G-protein coupled receptor 74, G-protein coupled receptor HLWAR77, Neuropeptide G-protein coupled receptor) (AP) discontinued

Sign In for Pricing
View Details
CDK5R1 Protein Vector (Rat) (pPB-N-His)
PV259103 500 ng

CDK5R1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
ROCK2 Rabbit Monoclonal Antibody
E49Y6985 100 µL

ROCK2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details