Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSRC1 Rabbit Polyclonal Antibody (HRP)

PSRC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DDA3, FP3214

UniProt

Q6PGN9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PSRC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGSGEFVGLTLKFLHPSPPGPPTPIRSVLAPQPSTSNSQRLPRPQGAAAK

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Rabbit Monoclonal Antibody [KD Validation]
E51K61350 40 µL

CD44 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
THUMPD1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
46679154 3x 1.0 µg DNA

THUMPD1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
C11orf34 CRISPR Knock Out 293T Cell Line (Human)
13686141 1x 10^6 Cells / 1.0 mL

C11orf34 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Lentiviral mouse Rps3 shRNA (UAS) - Lentiviral mouse Rps3 shRNA (UAS) (100)
GTR15137322 1 Vial

Lentiviral mouse Rps3 shRNA (UAS) - Lentiviral mouse Rps3 shRNA (UAS) (100)

Sign In for Pricing
View Details
Anti-Cdc20 Antibody Picoband® Fluoro550 Conjugated
A00382-1-Fluoro550 100 µg/Vial

Anti-Cdc20 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)
TRV-0021709-01 100 µL

FITC-Linked Polyclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)

Sign In for Pricing
View Details