Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP3 Rabbit Polyclonal Antibody (FITC)

CASP3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CPP32, SCA-1, CPP32B

UniProt

P42574

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CASP3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_004337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Tumor Necrosis Factor Alpha (TNFa)
TRV-0032971-01 20 µL

Monoclonal Antibody to Tumor Necrosis Factor Alpha (TNFa)

Sign In for Pricing
View Details
Monoclonal Antibody to Tumor Necrosis Factor Alpha (TNFa)
TRV-0032971-02 100 µL

Monoclonal Antibody to Tumor Necrosis Factor Alpha (TNFa)

Sign In for Pricing
View Details
Monoclonal Antibody to Tumor Necrosis Factor Alpha (TNFa)
TRV-0032971-03 200 µL

Monoclonal Antibody to Tumor Necrosis Factor Alpha (TNFa)

Sign In for Pricing
View Details
Monoclonal Antibody to Tumor Necrosis Factor Alpha (TNFa)
TRV-0032971-04 1 mL

Monoclonal Antibody to Tumor Necrosis Factor Alpha (TNFa)

Sign In for Pricing
View Details
ZNF771 Human Over-expression Lysate
orb1349009 100 µg

ZNF771 Human Over-expression Lysate

Sign In for Pricing
View Details
ASPDH Rabbit Polyclonal Antibody (Biotin)
orb2103796 100 µL

ASPDH Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details