Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFSF10 Rabbit Polyclonal Antibody (HRP)

TNFSF10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TL2, APO2L, CD253, TRAIL, Apo-2L, TNLG6A

UniProt

P50591

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TNFSF10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_003801

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Muscle tissue
CB513523 1 Block

Frozen Tissue Blocks, Muscle tissue

Sign In for Pricing
View Details
Tide Quencher™ 4WS alkyne [TQ4WS alkyne]
2069-AAT 1 mg

Tide Quencher™ 4WS alkyne [TQ4WS alkyne]

Sign In for Pricing
View Details
JIP1 (MAPK8IP1) Mouse Monoclonal Antibody [Clone ID: OTI1D9]
CF809895 100 µg

JIP1 (MAPK8IP1) Mouse Monoclonal Antibody [Clone ID: OTI1D9]

Sign In for Pricing
View Details
FCGR2B Antibody
KC-3912-01 50 μL

FCGR2B Antibody

Sign In for Pricing
View Details
FCGR2B Antibody
KC-3912-02 100 µL

FCGR2B Antibody

Sign In for Pricing
View Details
FCGR2B Antibody
KC-3912-03 1 mL

FCGR2B Antibody

Sign In for Pricing
View Details