Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFSF10 Rabbit Polyclonal Antibody (HRP)

TNFSF10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TL2, APO2L, CD253, TRAIL, Apo-2L, TNLG6A

UniProt

P50591

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TNFSF10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_003801

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMPR2 (NM_001002002) Human Recombinant Protein
TP323106L 1 mg

GMPR2 (NM_001002002) Human Recombinant Protein

Sign In for Pricing
View Details
Human CKLF activation kit by CRISPRa
GA109638 1 Kit

Human CKLF activation kit by CRISPRa

Sign In for Pricing
View Details
GCSF Receptor (CSF3R) (NM_000760) Human Over-expression Lysate
LY424528 100 µg

GCSF Receptor (CSF3R) (NM_000760) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Ubiquitin K63 Monoclonal Antibody
E-AB-81618-01 50 µL

Recombinant Ubiquitin K63 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Ubiquitin K63 Monoclonal Antibody
E-AB-81618-02 100 µL

Recombinant Ubiquitin K63 Monoclonal Antibody

Sign In for Pricing
View Details
(R)-(+)-Propylene Oxide
TRC-P835260-1G 1 g

(R)-(+)-Propylene Oxide

Sign In for Pricing
View Details