Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK6 Rabbit Polyclonal Antibody (FITC)

CDK6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MCPH12, PLSTIRE

UniProt

Q00534

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CDK6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001250

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAK (Apoptosis Regulator Bak, BCL2-antagonist/killer 1, BAK 1, BAK1, BAK-like, Bak NT, Bcl 2-like 7 Protein, BCL2L7, Cell Death Inhibitor 1, CDN 1, CDN1, MGC117255, MGC3887, NBak, Pro Apoptotic Protein BAK) (AP) discontinued
B0055-01Q-AP 100 µL

BAK (Apoptosis Regulator Bak, BCL2-antagonist/killer 1, BAK 1, BAK1, BAK-like, Bak NT, Bcl 2-like 7 Protein, BCL2L7, Cell Death Inhibitor 1, CDN 1, CDN1, MGC117255, MGC3887, NBak, Pro Apoptotic Protein BAK) (AP) discontinued

Sign In for Pricing
View Details
EBV lytic cycle inducer-1
T77753-01 1 mg

EBV lytic cycle inducer-1

Sign In for Pricing
View Details
EBV lytic cycle inducer-1
T77753-02 5 mg

EBV lytic cycle inducer-1

Sign In for Pricing
View Details
EBV lytic cycle inducer-1
T77753-03 10 mg

EBV lytic cycle inducer-1

Sign In for Pricing
View Details
EBV lytic cycle inducer-1
T77753-04 25 mg

EBV lytic cycle inducer-1

Sign In for Pricing
View Details
EBV lytic cycle inducer-1
T77753-05 50 mg

EBV lytic cycle inducer-1

Sign In for Pricing
View Details