Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK7 Rabbit Polyclonal Antibody (Biotin)

CDK7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CAK, CAK1, HCAK, MO15, STK1, CDKN7, p39MO15

UniProt

P50613

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CDK7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001790

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGHD2OR15-2A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1028306 1.0 µg DNA

IGHD2OR15-2A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
GRAMD1B protein, Human, Recombinant (His)
E51P91296 20 µg

GRAMD1B protein, Human, Recombinant (His)

Sign In for Pricing
View Details
PCIF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1610807 1.0 µg DNA

PCIF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Nuclease sbcCD subunit C (sbcC), partial
MBS1145628 Inquire

Recombinant Staphylococcus aureus Nuclease sbcCD subunit C (sbcC), partial

Sign In for Pricing
View Details
ADA ELISA Kit (Mouse)
OKEH05529-96W 96 Well

ADA ELISA Kit (Mouse)

Sign In for Pricing
View Details
GC Column, H3-1, 50m*0.53mm*0.5um, 1pc/pk
14051037 1 PC

GC Column, H3-1, 50m*0.53mm*0.5um, 1pc/pk

Sign In for Pricing
View Details