Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC25C Rabbit Polyclonal Antibody (Biotin)

CDC25C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CDC25, PPP1R60

UniProt

P30307

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CDC25C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALRE

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_073720

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX4 Protein Vector (Mouse) (pPM-C-HA)
46309025 500 ng

TBX4 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human ICAM-3/CD50 Alexa Fluor 350 MAb (Clone 76203)
FAB8131U-100UG 100 µg

Human ICAM-3/CD50 Alexa Fluor 350 MAb (Clone 76203)

Sign In for Pricing
View Details
Recombinant Human SREBP2 Protein - (Dry Ice)
H00006721-Q01-10ug 10 µg

Recombinant Human SREBP2 Protein - (Dry Ice)

Sign In for Pricing
View Details
HTR3C, ID (HTR3C, 5-hydroxytryptamine receptor 3C, Serotonin receptor 3C) (AP) discontinued
036829-AP 200 µL

HTR3C, ID (HTR3C, 5-hydroxytryptamine receptor 3C, Serotonin receptor 3C) (AP) discontinued

Sign In for Pricing
View Details
LRRC41 ORF Vector (Human) (pORF)
ORF006084 1.0 µg DNA

LRRC41 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PRO0618 Human shRNA Plasmid Kit (Locus ID 29052)
TR317128 1 Kit

PRO0618 Human shRNA Plasmid Kit (Locus ID 29052)

Sign In for Pricing
View Details