Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC25C Rabbit Polyclonal Antibody (Biotin)

CDC25C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CDC25, PPP1R60

UniProt

P30307

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CDC25C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALRE

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_073720

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NIPBL Antibody [HRP]
NB100-93320H 0.1 mL

Rabbit Polyclonal NIPBL Antibody [HRP]

Sign In for Pricing
View Details
Recombinant Human TNF Receptor Superfamily Member 11B/OPG Protein (C-Fc)
ARP5745-01 10 µg

Recombinant Human TNF Receptor Superfamily Member 11B/OPG Protein (C-Fc)

Sign In for Pricing
View Details
Recombinant Human TNF Receptor Superfamily Member 11B/OPG Protein (C-Fc)
ARP5745-02 50 µg

Recombinant Human TNF Receptor Superfamily Member 11B/OPG Protein (C-Fc)

Sign In for Pricing
View Details
Recombinant Human TNF Receptor Superfamily Member 11B/OPG Protein (C-Fc)
ARP5745-03 100 µg

Recombinant Human TNF Receptor Superfamily Member 11B/OPG Protein (C-Fc)

Sign In for Pricing
View Details
Recombinant Human TNF Receptor Superfamily Member 11B/OPG Protein (C-Fc)
ARP5745-04 1 mg

Recombinant Human TNF Receptor Superfamily Member 11B/OPG Protein (C-Fc)

Sign In for Pricing
View Details
Camel Uncharacterized Protein C13orf27 (C13ORF27) ELISA Kit
MBS9934928 Inquire

Camel Uncharacterized Protein C13orf27 (C13ORF27) ELISA Kit

Sign In for Pricing
View Details