Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN2B Rabbit Polyclonal Antibody (HRP)

CDKN2B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P15, MTS2, TP15, CDK4I, INK4B, p15INK4b

UniProt

P42772

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CDKN2B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: REGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD

Field of Research

Cancer Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004927

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calbindin Rabbit pAb
orb2711731-01 50 µL

Calbindin Rabbit pAb

Sign In for Pricing
View Details
Calbindin Rabbit pAb
orb2711731-02 100 µL

Calbindin Rabbit pAb

Sign In for Pricing
View Details
Istradefylline Impurity 21
RM-I190421-01 10 mg

Istradefylline Impurity 21

Sign In for Pricing
View Details
Istradefylline Impurity 21
RM-I190421-02 25 mg

Istradefylline Impurity 21

Sign In for Pricing
View Details
Istradefylline Impurity 21
RM-I190421-03 50 mg

Istradefylline Impurity 21

Sign In for Pricing
View Details
Istradefylline Impurity 21
RM-I190421-04 100 mg

Istradefylline Impurity 21

Sign In for Pricing
View Details