Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF1 Rabbit Polyclonal Antibody (HRP)

TRAF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EBI6, MGC:10353

UniProt

Q13077

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRAF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005649

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Synuclein Alpha Interacting Protein 1 (SNCaIP1)
TRV-0050587-01 20 µL

Polyclonal Antibody to Synuclein Alpha Interacting Protein 1 (SNCaIP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Synuclein Alpha Interacting Protein 1 (SNCaIP1)
TRV-0050587-02 100 µL

Polyclonal Antibody to Synuclein Alpha Interacting Protein 1 (SNCaIP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Synuclein Alpha Interacting Protein 1 (SNCaIP1)
TRV-0050587-03 200 µL

Polyclonal Antibody to Synuclein Alpha Interacting Protein 1 (SNCaIP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Synuclein Alpha Interacting Protein 1 (SNCaIP1)
TRV-0050587-04 1 mL

Polyclonal Antibody to Synuclein Alpha Interacting Protein 1 (SNCaIP1)

Sign In for Pricing
View Details
TOR2A (TORP1, Torsin-2A, Torsin Family 2 Member A, Torsin-related Protein 1, UNQ6408/PRO21181, FLJ14771, HEMBA1005096, MGC99558, Prosalusin, PSEC0218) (MaxLight 550)
MBS6403140-01 0.1 mL

TOR2A (TORP1, Torsin-2A, Torsin Family 2 Member A, Torsin-related Protein 1, UNQ6408/PRO21181, FLJ14771, HEMBA1005096, MGC99558, Prosalusin, PSEC0218) (MaxLight 550)

Sign In for Pricing
View Details
TOR2A (TORP1, Torsin-2A, Torsin Family 2 Member A, Torsin-related Protein 1, UNQ6408/PRO21181, FLJ14771, HEMBA1005096, MGC99558, Prosalusin, PSEC0218) (MaxLight 550)
MBS6403140-02 5x 0.1 mL

TOR2A (TORP1, Torsin-2A, Torsin Family 2 Member A, Torsin-related Protein 1, UNQ6408/PRO21181, FLJ14771, HEMBA1005096, MGC99558, Prosalusin, PSEC0218) (MaxLight 550)

Sign In for Pricing
View Details