Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF1 Rabbit Polyclonal Antibody (HRP)

TRAF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EBI6, MGC:10353

UniProt

Q13077

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRAF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005649

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4,5-Trichloronitrobenzene- 13C6
TRC-T774316-0.5MG 0.5 mg

2,4,5-Trichloronitrobenzene- 13C6

Sign In for Pricing
View Details
CDK8, ID (CDK8, Cyclin-dependent kinase 8, Cell division protein kinase 8, Mediator complex subunit CDK8, Mediator of RNA polymerase II transcription subunit CDK8, Protein kinase K35)
033682 200 µL

CDK8, ID (CDK8, Cyclin-dependent kinase 8, Cell division protein kinase 8, Mediator complex subunit CDK8, Mediator of RNA polymerase II transcription subunit CDK8, Protein kinase K35)

Sign In for Pricing
View Details
MAS1 (Proto-oncogene Mas, MAS, MGC119966) (MaxLight 490)
138116-ML490 100 µL

MAS1 (Proto-oncogene Mas, MAS, MGC119966) (MaxLight 490)

Sign In for Pricing
View Details
Nmt1 Rat shRNA Plasmid (Locus ID 259274)
TR713174 1 Kit

Nmt1 Rat shRNA Plasmid (Locus ID 259274)

Sign In for Pricing
View Details
LSMD1 AAV Vector (Mouse) (CMV)
27753104 1 µg

LSMD1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
PROX2 Protein Vector (Rat) (pPB-C-His)
PV296402 500 ng

PROX2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details