Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIDEB Rabbit Polyclonal Antibody (Biotin)

CIDEB Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9UHD4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CIDEB

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHS

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_055245

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACADM  polyclonal antibody
BZ16580 50ul

ACADM polyclonal antibody

Sign In for Pricing
View Details
Tmem121 Mouse Gene Knockout Kit (CRISPR)
KN517707 1 Kit

Tmem121 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD1E CRISPR Knock Out 293T Cell Line (Human)
15487141 1x 10^6 Cells / 1.0 mL

CD1E CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
ZNF474 Antibody - middle region
ARP31557_P050-25UL 25 µL

ZNF474 Antibody - middle region

Sign In for Pricing
View Details
Simian VCAM1 (Vascular Cell Adhesion Molecule 1) ELISA Kit
EK247282 96 Well

Simian VCAM1 (Vascular Cell Adhesion Molecule 1) ELISA Kit

Sign In for Pricing
View Details
TFPT sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2363508 1.0 µg DNA

TFPT sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details