Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRP Rabbit Polyclonal Antibody (HRP)

GABRP Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O00591

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GABRP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055026

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Receptor I For The Fc Region Of Immunoglobulin E (FceRI) ELISA Kit
orb1666444-01 48 Tests

Mouse Receptor I For The Fc Region Of Immunoglobulin E (FceRI) ELISA Kit

Sign In for Pricing
View Details
Mouse Receptor I For The Fc Region Of Immunoglobulin E (FceRI) ELISA Kit
orb1666444-02 96 Tests

Mouse Receptor I For The Fc Region Of Immunoglobulin E (FceRI) ELISA Kit

Sign In for Pricing
View Details
ABCA1 (ATP Binding Cassette Transporter A1) BioAssayTM ELISA Kit (Mouse) discontinued
381778 96 Tests

ABCA1 (ATP Binding Cassette Transporter A1) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Tas2r105 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
46143116 3x 1.0 µg

Tas2r105 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal Collagen VI alpha 3 Antibody [mFluor Violet 610 SE]
NBP2-97125MFV610 0.1 mL

Rabbit Polyclonal Collagen VI alpha 3 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
5-Hydroxyindole-2-carboxylic Acid (Highly Pure)
B2016293 5 g

5-Hydroxyindole-2-carboxylic Acid (Highly Pure)

Sign In for Pricing
View Details