Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNB1 Rabbit Polyclonal Antibody (HRP)

CTNNB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EVR7, CTNNB, MRD19, NEDSDV, armadillo

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CTNNB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

XP_001133664

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIPK2, CT (Homeodomain Interacting Protein Kinase 2, hHIPk2, DKFZp686K02111, FLJ23711, PRO0593) (MaxLight 405) discontinued
H4065-10E-ML405 100 µL

HIPK2, CT (Homeodomain Interacting Protein Kinase 2, hHIPk2, DKFZp686K02111, FLJ23711, PRO0593) (MaxLight 405) discontinued

Sign In for Pricing
View Details
GINM1 Knockout NCI-H1975 Polyclonal Cells
ARG17328 1 Million

GINM1 Knockout NCI-H1975 Polyclonal Cells

Sign In for Pricing
View Details
SSBP1 (Single-stranded DNA-Binding Protein, Mitochondrial, Mt-SSB, MtSSB, PWP1-interacting Protein 17, SSBP1, SSBP)
335570-01 50 µg

SSBP1 (Single-stranded DNA-Binding Protein, Mitochondrial, Mt-SSB, MtSSB, PWP1-interacting Protein 17, SSBP1, SSBP)

Sign In for Pricing
View Details
SSBP1 (Single-stranded DNA-Binding Protein, Mitochondrial, Mt-SSB, MtSSB, PWP1-interacting Protein 17, SSBP1, SSBP)
335570-02 100 µg

SSBP1 (Single-stranded DNA-Binding Protein, Mitochondrial, Mt-SSB, MtSSB, PWP1-interacting Protein 17, SSBP1, SSBP)

Sign In for Pricing
View Details
Ubiquitin (MaxLight 650)
MBS6259895-01 0.1 mL

Ubiquitin (MaxLight 650)

Sign In for Pricing
View Details
Ubiquitin (MaxLight 650)
MBS6259895-02 5x 0.1 mL

Ubiquitin (MaxLight 650)

Sign In for Pricing
View Details