Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAD3 Rabbit Polyclonal Antibody (FITC)

SMAD3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LDS3, LDS1C, MADH3, JV15-2, HSPC193, HsT17436

UniProt

P84022

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAIT

Field of Research

Cancer Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005893

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Krtap9-1 3'UTR Luciferase Stable Cell Line
TU206902 1.0 mL

Krtap9-1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Pig complement fragment 5a ELISA Kit
orb409709-01 24 Tests

Pig complement fragment 5a ELISA Kit

Sign In for Pricing
View Details
Pig complement fragment 5a ELISA Kit
orb409709-02 48 Tests

Pig complement fragment 5a ELISA Kit

Sign In for Pricing
View Details
Pig complement fragment 5a ELISA Kit
orb409709-03 96 Tests

Pig complement fragment 5a ELISA Kit

Sign In for Pricing
View Details
Pig complement fragment 5a ELISA Kit
orb409709-04 5 x 96 T

Pig complement fragment 5a ELISA Kit

Sign In for Pricing
View Details
Pig complement fragment 5a ELISA Kit
orb409709-05 10 x 96 T

Pig complement fragment 5a ELISA Kit

Sign In for Pricing
View Details