Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAD6 Rabbit Polyclonal Antibody (FITC)

SMAD6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AOVD2, MADH6, MADH7, HsT17432

UniProt

O43541

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GAPRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKRLKE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_005576

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lysophospholipase 1 (LYPLA1) activation kit by CRISPRa
GA107114 1 Kit

Human Lysophospholipase 1 (LYPLA1) activation kit by CRISPRa

Sign In for Pricing
View Details
ZNF616 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2720106 1.0 µg DNA

ZNF616 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Proz (NM_025834) Mouse Tagged ORF Clone
MG224558 10 µg

Proz (NM_025834) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Lima1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4943103 1.0 µg DNA

Lima1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Methyl 3-hydroxy-3-methylbutanoate
GAA14945 2.5 g

Methyl 3-hydroxy-3-methylbutanoate

Sign In for Pricing
View Details
Human Interleukin-1 alpha ELISA Kit
MBS2883562-01 48 Well

Human Interleukin-1 alpha ELISA Kit

Sign In for Pricing
View Details