Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF4 Rabbit Polyclonal Antibody (Biotin)

TCF4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

E2-2, ITF2, PTHS, SEF2, CDG2T, FECD3, ITF-2, SEF-2, TCF-4, SEF2-1, SEF2-1A, SEF2-1B, SEF2-1D, bHLHb19

UniProt

P15884

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TCF4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCH

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_003190

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Programmed cell death protein 5 (PDCD5)
MBS1413145-01 0.02 mg (E-Coli)

Recombinant Bovine Programmed cell death protein 5 (PDCD5)

Sign In for Pricing
View Details
Recombinant Bovine Programmed cell death protein 5 (PDCD5)
MBS1413145-02 0.1 mg (E-Coli)

Recombinant Bovine Programmed cell death protein 5 (PDCD5)

Sign In for Pricing
View Details
Recombinant Bovine Programmed cell death protein 5 (PDCD5)
MBS1413145-03 0.02 mg (Yeast)

Recombinant Bovine Programmed cell death protein 5 (PDCD5)

Sign In for Pricing
View Details
Recombinant Bovine Programmed cell death protein 5 (PDCD5)
MBS1413145-04 0.1 mg (Yeast)

Recombinant Bovine Programmed cell death protein 5 (PDCD5)

Sign In for Pricing
View Details
Recombinant Bovine Programmed cell death protein 5 (PDCD5)
MBS1413145-05 0.02 mg (Baculovirus)

Recombinant Bovine Programmed cell death protein 5 (PDCD5)

Sign In for Pricing
View Details
Recombinant Bovine Programmed cell death protein 5 (PDCD5)
MBS1413145-06 0.02 mg (Mammalian-Cell)

Recombinant Bovine Programmed cell death protein 5 (PDCD5)

Sign In for Pricing
View Details