Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU2F1 Rabbit Polyclonal Antibody (HRP)

POU2F1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OCT1, OTF1, Oct1Z, oct-1B

UniProt

P14859

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002688

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GP1BA Rabbit Polyclonal Antibody (HRP)
orb474529 100 µL

GP1BA Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Human Cysteinyl Leukotriene Receptor 1 ELISA Kit
MBS765256-01 48 Well

Human Cysteinyl Leukotriene Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Human Cysteinyl Leukotriene Receptor 1 ELISA Kit
MBS765256-02 96 Well

Human Cysteinyl Leukotriene Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Human Cysteinyl Leukotriene Receptor 1 ELISA Kit
MBS765256-03 5x 96 Well

Human Cysteinyl Leukotriene Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Human Cysteinyl Leukotriene Receptor 1 ELISA Kit
MBS765256-04 10x 96 Well

Human Cysteinyl Leukotriene Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Azoarcus sp. UPF0246 protein azo1887 (azo1887)
MBS1254196-01 0.02 mg (E-Coli)

Recombinant Azoarcus sp. UPF0246 protein azo1887 (azo1887)

Sign In for Pricing
View Details