Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFEB Rabbit Polyclonal Antibody (HRP)

TFEB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TCFEB, BHLHE35, ALPHATFEB

UniProt

P19484

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TFEB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRR

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Endothelial NOS (eNOS)
TRV-0053327-01 20 µL

Polyclonal Antibody to Endothelial NOS (eNOS)

Sign In for Pricing
View Details
Polyclonal Antibody to Endothelial NOS (eNOS)
TRV-0053327-02 100 µL

Polyclonal Antibody to Endothelial NOS (eNOS)

Sign In for Pricing
View Details
Polyclonal Antibody to Endothelial NOS (eNOS)
TRV-0053327-03 200 µL

Polyclonal Antibody to Endothelial NOS (eNOS)

Sign In for Pricing
View Details
Polyclonal Antibody to Endothelial NOS (eNOS)
TRV-0053327-04 1 mL

Polyclonal Antibody to Endothelial NOS (eNOS)

Sign In for Pricing
View Details
C-myc (Myc, myc-1, Cellular myelocytomatosis oncogene, Myc2, Niard, Nird, Transcription factor p64, v-myc avian myelocytomatosis viral oncogene homolog) discontinued
C0035-05D 1 mL

C-myc (Myc, myc-1, Cellular myelocytomatosis oncogene, Myc2, Niard, Nird, Transcription factor p64, v-myc avian myelocytomatosis viral oncogene homolog) discontinued

Sign In for Pricing
View Details
Mouse Cdkn2aipnl Pre-designed siRNA Set B
SI102292B 1 Each

Mouse Cdkn2aipnl Pre-designed siRNA Set B

Sign In for Pricing
View Details