Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD18B Rabbit Polyclonal Antibody (HRP)

ANKRD18B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BA255A11.3, bA255A11.5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANKRD18B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QVNIPDIIHIHKEALTKVMESRQHVAEGKTEVQRLMMSESQEQDFFGHCG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

149kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_001716377

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLC4 (NM_201522) Human Over-expression Lysate
LH16536V 100 µg

KLC4 (NM_201522) Human Over-expression Lysate

Sign In for Pricing
View Details
Human WHRN shRNA Plasmid
abx958549-01 150 µg

Human WHRN shRNA Plasmid

Sign In for Pricing
View Details
Human WHRN shRNA Plasmid
abx958549-02 300 µg

Human WHRN shRNA Plasmid

Sign In for Pricing
View Details
Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Epsilon (IkBe)
MBS2026178-01 0.1 mL

Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Epsilon (IkBe)

Sign In for Pricing
View Details
Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Epsilon (IkBe)
MBS2026178-02 0.2 mL

Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Epsilon (IkBe)

Sign In for Pricing
View Details
Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Epsilon (IkBe)
MBS2026178-03 0.5 mL

Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Epsilon (IkBe)

Sign In for Pricing
View Details