Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSRNP2 Rabbit Polyclonal Antibody (HRP)

CSRNP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C12orf2, PPP1R72, TAIP-12, C12orf22, FAM130A1

UniProt

Q9H175

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CSRNP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PAALCKSEVGKTPTLEALLPEDCNPEEPENEDFHPSWSPSSLPFRTDNEE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_110436

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC2 (D10Wsu179e, HD 2, HD2, HDAC 2, Hdac2, HDAC2_HUMAN, Histone Deacetylase 2 (HD2), Histone Deacetylase 2, OTTHUMP00000017046, OTTHUMP00000227077, OTTHUMP00000227078, RPD3, Transcriptional regulator Homolog RPD3, YAF1, YY1 Associated Factor 1, YY1 Transcription Factor Binding Protein, Yy1bp)
254072 100 µL

HDAC2 (D10Wsu179e, HD 2, HD2, HDAC 2, Hdac2, HDAC2_HUMAN, Histone Deacetylase 2 (HD2), Histone Deacetylase 2, OTTHUMP00000017046, OTTHUMP00000227077, OTTHUMP00000227078, RPD3, Transcriptional regulator Homolog RPD3, YAF1, YY1 Associated Factor 1, YY1 Transcription Factor Binding Protein, Yy1bp)

Sign In for Pricing
View Details
Filler vials for CoolCell freezing container
432077 10 / PCK

Filler vials for CoolCell freezing container

Sign In for Pricing
View Details
RTN4R Protein Vector (Human) (pPM-C-His)
PV036536 500 ng

RTN4R Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
PDRG1 (C20orf126, PDRG) discontinued
512637 100 µg

PDRG1 (C20orf126, PDRG) discontinued

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)
MBS2038001-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)
MBS2038001-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)

Sign In for Pricing
View Details