Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MINDY4 Rabbit Polyclonal Antibody (HRP)

MINDY4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AQP1, AQP-1, CHIP28, C7orf67, FAM188B

UniProt

Q4G0A6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM188B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HSEPSLDVKRMGENSRPKSGLIVRGMMSGPIASSPQDSFHRHYLRRSSPS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_115598

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ufm1 shRNA (UAS) - Lentiviral mouse Ufm1 shRNA (UAS, GFP) plasmid
GTR15242158 1 Vial

Lentiviral mouse Ufm1 shRNA (UAS) - Lentiviral mouse Ufm1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
FUT2 Rabbit Polyclonal Antibody
orb1100685-01 50 µg

FUT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FUT2 Rabbit Polyclonal Antibody
orb1100685-02 100 µg

FUT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human CD134/TNFRSF4/OX40 Antibody (SAA0052), APC
HW342237-01 1 Each

Anti-Human CD134/TNFRSF4/OX40 Antibody (SAA0052), APC

Sign In for Pricing
View Details
Anti-Human CD134/TNFRSF4/OX40 Antibody (SAA0052), APC
HW342237-02 100 Tests

Anti-Human CD134/TNFRSF4/OX40 Antibody (SAA0052), APC

Sign In for Pricing
View Details
KIF1A Rabbit Polyclonal Antibody (FITC)
orb2135851 100 µL

KIF1A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details