Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GUCY1A2 Rabbit Polyclonal Antibody (HRP)

GUCY1A2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GC-SA2, GUC1A2

UniProt

P33402

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GUCY1A2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KNFHNISNRCSYADHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001243353

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RPB9 antibody
STJ190765 200 µl

Anti-RPB9 antibody

Sign In for Pricing
View Details
Donkey Rat IgG Heavy and Light Chain Cross-Adsorbed Antibody (Biotin)
orb1531120 0.5 mg

Donkey Rat IgG Heavy and Light Chain Cross-Adsorbed Antibody (Biotin)

Sign In for Pricing
View Details
TMEM105 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2396005 3x 1.0 µg

TMEM105 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
MAGI2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
27952156 3x 1.0 µg DNA

MAGI2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Human SPDYE3 Pre-designed siRNA Set B
SI015629B 1 Each

Human SPDYE3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
WARS, CT (WARS, IFI53, WRS, Tryptophan-tRNA ligase, cytoplasmic, Interferon-induced protein 53, Tryptophanyl-tRNA synthetase, T1-TrpRS, T2-TrpRS) (MaxLight 750) discontinued
043801-ML750 100 µL

WARS, CT (WARS, IFI53, WRS, Tryptophan-tRNA ligase, cytoplasmic, Interferon-induced protein 53, Tryptophanyl-tRNA synthetase, T1-TrpRS, T2-TrpRS) (MaxLight 750) discontinued

Sign In for Pricing
View Details