Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASF1A Rabbit Polyclonal Antibody (HRP)

ASF1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CIA, CGI-98, HSPC146

UniProt

Q9Y294

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ASF1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSE

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_054753

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCC2 Antibody
AF9180-01 100 µL

RCC2 Antibody

Sign In for Pricing
View Details
RCC2 Antibody
AF9180-02 200 µL

RCC2 Antibody

Sign In for Pricing
View Details
Stx1a 3'UTR GFP Stable Cell Line
TU169894 1.0 mL

Stx1a 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MEK1, MEK2, phosphorylated (Ser218/222) (MAPK/ERK Kinase 1, MEK 1, Dual Specificity Mitogen-activated Protein Kinase Kinase 1, MAP Kinase Kinase 1, MAP2K1, MAPKK 1, MKK1, PRKMK1, ERK Activator Kinase 1 / MAPK/ERK Kinase 2, Dual Specificity Mitogen-activated Protein Kinase Kinase 2, MAP Kinase Kinase 2, MAP2K2, MAPKK 2, MKK2, PRKMK2, ERK Activator Kinase 2) (APC) discontinued
M2865-03B-APC 100 µL

MEK1, MEK2, phosphorylated (Ser218/222) (MAPK/ERK Kinase 1, MEK 1, Dual Specificity Mitogen-activated Protein Kinase Kinase 1, MAP Kinase Kinase 1, MAP2K1, MAPKK 1, MKK1, PRKMK1, ERK Activator Kinase 1 / MAPK/ERK Kinase 2, Dual Specificity Mitogen-activated Protein Kinase Kinase 2, MAP Kinase Kinase 2, MAP2K2, MAPKK 2, MKK2, PRKMK2, ERK Activator Kinase 2) (APC) discontinued

Sign In for Pricing
View Details
S100A2 (S100 Calcium Binding Protein A2, CAN19, MGC111539, S100L) (MaxLight 650)
251381-ML650 100 µL

S100A2 (S100 Calcium Binding Protein A2, CAN19, MGC111539, S100L) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant C Reactive Protein (CRP)
MBS2009122-01 0.01 mg

Recombinant C Reactive Protein (CRP)

Sign In for Pricing
View Details